DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG11843

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:252 Identity:85/252 - (33%)
Similarity:126/252 - (50%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IFGGDVGNPHCFPYQVGMLLQRP----KGLYWCGGSLISDKHVITAAHCVDMAKRA--LVFLGAN 181
            |.||....|..||: :..|.:||    :..::|||.|||::.|:|||||::..:..  :|.||..
  Fly    68 IVGGHPAQPREFPH-MARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGEL 131

  Fly   182 EIKNAKEKGQVR-LMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRS 245
            :..:..|....| .||  ..:..:|.:...:...||.:|:|..||.|:...||..||  ..:.||
  Fly   132 DFDSLDEDAAPRDYMV--AGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLP--FQDERS 192

  Fly   246 FKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCK-------SNFPLSYRGTN-ICTSGRN 302
            ..:.:|:  |||.....:...:.:|: |:||......||       ..||..:.|.| :|.....
  Fly   193 SDSFIAV--GWGSTGLALKPSAQLLK-VKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEM 254

  Fly   303 ARSTCNGDSGGPLVL-QRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWIS 358
            |:.||||||||||:: .|.:....|:|||||.|...| ..|.|..:|:|..||.||:
  Fly   255 AQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWIA 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 83/249 (33%)
Tryp_SPc 123..359 CDD:238113 85/252 (34%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 85/252 (34%)
Tryp_SPc 68..309 CDD:214473 83/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.