DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG11842

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:285 Identity:86/285 - (30%)
Similarity:132/285 - (46%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPY--QVGMLLQRPKGLYWCGGSLISDKHVITAA 165
            :|..|::.|.|.:.......|.||....|..||:  ::|...:..:..::|||:||||:||:|||
  Fly    53 IENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAA 117

  Fly   166 HC-------VDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPH 223
            ||       |::|:...:....|......|...|:      :|..:|.::...:.:||::|||..
  Fly   118 HCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVK------DFTAHPEFSYPAIYNDISVVRLSR 176

  Fly   224 AVSFNERIHPIQLPKRHYEYRSFKN-KLA---IASGWGRYATGVHAISNVLRYVQLQIIDGRTCK 284
            .|:||:..||..||        |.: :|.   ||.|||:........:..|:.|:|... |..|:
  Fly   177 PVTFNDYKHPACLP--------FDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNY-GTRCR 232

  Fly   285 ------SNFPLSYRG-TNICTSGRNARSTCNGDSGGPLVLQRR------HSKKRVLVGITSFGSI 336
                  ...|..|.. |.:|......:.|||||||||:::...      |     ::||||.|  
  Fly   233 ITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYH-----VMGITSIG-- 290

  Fly   337 YGCDR-GYPAAFTKVASYLDWISDE 360
            ..||. ..||.:|:|..|||||..:
  Fly   291 VACDTPDLPAMYTRVHFYLDWIKQQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 80/261 (31%)
Tryp_SPc 123..359 CDD:238113 82/262 (31%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 82/263 (31%)
Tryp_SPc 73..312 CDD:214473 80/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.