DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG4815

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:297 Identity:68/297 - (22%)
Similarity:110/297 - (37%) Gaps:90/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SALSEEDDREPLVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCG 152
            |..:|..:||      |.|......:..|........||           ||:.|...:.|. |.
  Fly    16 SVRTEAGNRE------EWTGRFHPRIYNGIKTTVESLGG-----------VGIQLFNGRKLV-CS 62

  Fly   153 GSLISDKHVITAAHCVDMAKRA-----------LVFLGANEIKNAKEKGQVRLMVPSENFQIYPT 206
            .:|::.:|::|||||.:...|:           ..:.|.|..||       :|:    ..||:|.
  Fly    63 ATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKN-------KLI----RVQIHPK 116

  Fly   207 WNPKRLKDDIAIVR---------LPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATG 262
            :...:...|:|:.:         :.:|......:||             ::|| ||:||| :..|
  Fly   117 YAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHP-------------RDKL-IAAGWG-FEGG 166

  Fly   263 V--HAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRR----- 320
            |  .:.....|.:::.|:..|.|:...........||....|.::.|.|||||||:|.|:     
  Fly   167 VWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGIN 231

  Fly   321 --------HSKKRVLVGITSFGSIYGCDRGYPAAFTK 349
                    :.|..|.:|:.           |.|.|.|
  Fly   232 TWTFKCGNNEKPDVYMGVR-----------YYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 61/263 (23%)
Tryp_SPc 123..359 CDD:238113 61/262 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 59/247 (24%)
Trypsin 49..256 CDD:278516 57/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.