DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Tmprss9

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:278 Identity:76/278 - (27%)
Similarity:132/278 - (47%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDM---AKR 173
            :.|.||:.  ||.||...:...:|:||.:.|:|.:  :.||..|::::.:::||||.|:   ..:
Mouse  1076 LAPPGALT--RIVGGSAASLGEWPWQVSLWLRRRE--HRCGAVLVAERWLLSAAHCFDIYGDPMQ 1136

  Fly   174 ALVFLGANEIKNAKEKGQVRLMVPSENFQIY--PTWNPKRLKDDIAIVRLPHAVSFNERIHPIQL 236
            ...|||...:.:.  :||:..:.     :||  |.:|...|..|:|::.|...|..:..:.||.|
Mouse  1137 WAAFLGTPFLSST--EGQLERVA-----RIYRHPFYNIYTLDYDVALLELAGPVRRSRLVRPICL 1194

  Fly   237 PKRHYEYRSFKNKLAIASGWGRYAT-GVHA------------------------ISNVLRYVQLQ 276
            |.   ..|.......:.:|||.... |:||                        ::..|:...::
Mouse  1195 PG---PARPPDGARCVITGWGSLREGGIHACVRRSPGGVGDTPHLHLSPDPTGSMARQLQKAAVR 1256

  Fly   277 IIDGRTCKSNFPLSYRGTNICTS-GRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCD 340
            ::..:||:..:|:......:|.. .:....:|:||:||||.. |..|.:.||.|:||:|  |||.
Mouse  1257 VLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLAC-REPSGQWVLTGVTSWG--YGCG 1318

  Fly   341 R-GYPAAFTKVASYLDWI 357
            | .:|..:|:||:.|.||
Mouse  1319 RPHFPGVYTRVAAVLGWI 1336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/266 (27%)
Tryp_SPc 123..359 CDD:238113 72/267 (27%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113 70/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.