DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG31219

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:263 Identity:79/263 - (30%)
Similarity:131/263 - (49%) Gaps:38/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLY---WCGGSLISDKHVITAAHCVDMAKRAL----VFLG 179
            |:.||....|:.:|:...:|......|.   :|.||||::::|:|:||||:...|.|    |.||
  Fly    88 RMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLG 152

  Fly   180 ANEI-------KNAKEKGQVRLMVPSENFQ--------IYPTWNPKRLKDDIAIVRLPHAVSFNE 229
            .::|       .:.:::.. :..:|:...:        ::.:.:.:.::.|||::||...|.:..
  Fly   153 EHDITYDPAYNPDCRDQDN-QCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRT 216

  Fly   230 RIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGT 294
            .|.||.:||..:   ..|:||.|| |||:  |.....|.||.:..::......|...||  |...
  Fly   217 GIMPICIPKHGF---FAKSKLEIA-GWGK--TNEGQFSQVLMHGFIRERSIAVCALRFP--YLDL 273

  Fly   295 N----ICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYL 354
            |    ||..|.:...||.|||||||::...:|.. .|.|||::|| ..|.: |.|..:|:.:::|
  Fly   274 NQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV-YLAGITTYGS-KNCGQIGIPGIYTRTSAFL 336

  Fly   355 DWI 357
            .||
  Fly   337 PWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 77/261 (30%)
Tryp_SPc 123..359 CDD:238113 78/262 (30%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 77/261 (30%)
Tryp_SPc 90..342 CDD:238113 78/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.