DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG5246

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:259 Identity:75/259 - (28%)
Similarity:116/259 - (44%) Gaps:61/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCF-PYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKN 185
            |:.|| |.:|..| ||||.::  ...|.:.||||:|:.:.::|||||::...:.|..:       
  Fly    41 RVIGG-VDSPTGFAPYQVSIM--NTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIV------- 95

  Fly   186 AKEKGQVRLMVPSENF-----QIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQ------LPKR 239
               .|.|....|...:     :|:.:.:.....:|||::.....:.:::...||:      ||| 
  Fly    96 ---TGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPK- 156

  Fly   240 HYEYRSFKNKLAI-----ASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN---- 295
                  ..:||.:     ...||||:|       .|:.:.|..||...|:|.    .|..|    
  Fly   157 ------VGDKLTLTGWGSTKTWGRYST-------QLQKIDLNYIDHDNCQSR----VRNANWLSE 204

  Fly   296 --ICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
              :||..:....:|:||||||||     ...:.|||:.::|.  .|..|||..|..||.|.|||
  Fly   205 GHVCTFTQEGEGSCHGDSGGPLV-----DANQTLVGVVNWGE--ACAIGYPDVFGSVAYYHDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 73/257 (28%)
Tryp_SPc 123..359 CDD:238113 74/258 (29%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 73/257 (28%)
Tryp_SPc 42..263 CDD:238113 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436898
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.