DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG17475

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:259 Identity:76/259 - (29%)
Similarity:111/259 - (42%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EGAMAMDRIFGGD---VGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALV 176
            ||....:|:..|:   :|..   .||:.  ||...|.:.|||.:|.::||:||||||        
  Fly    42 EGVNFQNRVINGEDVQLGEA---KYQIS--LQGMYGGHICGGCIIDERHVLTAAHCV-------- 93

  Fly   177 FLGANEIKNAKEKGQVRLMVPS-----ENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQL 236
             .|.|........|.|....|.     |...|:..:|.....:|||::||...:.|||...|.:|
  Fly    94 -YGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAEL 157

  Fly   237 PKRHYEYRSFKNKLAIASGWGRYATGVHA-ISNVLRYVQLQIIDGRTCK-------SNFPLSYRG 293
            |.....    .....:.:|||  :|.:.. ..::|:...|..:...||:       ||.|     
  Fly   158 PTAPVA----NGTQLLLTGWG--STELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGP----- 211

  Fly   294 TNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
            .:|||.....:..|:|||||||      :...||.|:.::|  |.|..|.|.:...|..||:||
  Fly   212 CHICTLTTGGQGACHGDSGGPL------THNGVLYGLVNWG--YPCALGVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 72/250 (29%)
Tryp_SPc 123..359 CDD:238113 73/251 (29%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/250 (29%)
Tryp_SPc 50..269 CDD:238113 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.