DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and modSP

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:218 Identity:52/218 - (23%)
Similarity:81/218 - (37%) Gaps:52/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GGDVGNPHCFPYQVGMLLQRPKGLY--WCGGSLISDKHVITAAHCV-DMAKR------------A 174
            ||...|....|:.||:.:...:..|  .|||||::...|||||||| |...|            |
  Fly   371 GGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAA 435

  Fly   175 LVFLGANEIKNAKEKGQVRLMVPSENFQIYPTW--NPKRLKDDIAIVRLPHAVSFNERIHPIQLP 237
            ..:....|....:::..|||:      :|.|.:  ..:....|:|::.|......:..|.||.: 
  Fly   436 KFYRNYGETTPEEKRRDVRLI------EIAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICV- 493

  Fly   238 KRHYEYRSFKNKLAIA-------SGWGRYATGVHAISNVLRYVQLQII-----DGRTCKSNFPLS 290
                .:.||..|.::.       :||           |:....:||.:     ....|:.|. ..
  Fly   494 ----TFASFAEKESVTDDVQGKFAGW-----------NIENKHELQFVPAVSKSNSVCRRNL-RD 542

  Fly   291 YRGTNICTSGRNARSTCNGDSGG 313
            .:....|...:.....|.|||||
  Fly   543 IQADKFCIFTQGKSLACQGDSGG 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 52/218 (24%)
Tryp_SPc 123..359 CDD:238113 52/218 (24%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 52/218 (24%)
Tryp_SPc 371..591 CDD:304450 52/218 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.