DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG31326

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:356 Identity:92/356 - (25%)
Similarity:145/356 - (40%) Gaps:78/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QQVKPMYLVSMYPGPAGLSTSSSSPFSSSGSLEHDAEMSASNV---DNRHIKGLGMGREMSALSE 92
            ||..|...::..|..........:|..|..:....|..|..::   .|....|:..|||.::   
  Fly   208 QQANPNRGITSQPEIPSPVPQRPTPNPSRSNAPQQAVRSPVDLVPQQNPSSNGIPCGRERAS--- 269

  Fly    93 EDDREPLVLNLETTPLM--EKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKG--LYWCGG 153
                        ||||:  .|.|..|.:                |:.|.:..:|...  .:.|||
  Fly   270 ------------TTPLIFQGKSLQRGQL----------------PWLVAIFERRESNGPAFICGG 306

  Fly   154 SLISDKHVITAAHCV-----DM-AKRALVFLGANEI---KNAKEKGQVRLMVPSENFQIYPTWNP 209
            :|||...|::||||.     |: |.|..|.||.|.:   .:.:.:|..:|:: .||||.      
  Fly   307 TLISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLII-HENFQF------ 364

  Fly   210 KRLKD-DIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKL-------AIASGWGRYATGVHAI 266
            |:..: |:|:|||...|.:.:.|.||.|       .|..|::       :..:|||...||. ..
  Fly   365 KQFTEADLALVRLDEPVRYTDYIVPICL-------WSTSNRMDLPQGLKSYVAGWGPDETGT-GN 421

  Fly   267 SNVLRYVQLQIIDGRTCKSNFP-LSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGI 330
            :.|.:...|.|:....|....| :..:.:::|.. :.....|..|.||||:|  |.....||.|:
  Fly   422 TEVSKVTDLNIVSEANCALELPHVLVQPSSLCAK-KTGAGPCASDGGGPLML--REQDVWVLRGV 483

  Fly   331 TSFGSI----YGCDRGYPAAFTKVASYLDWI 357
            .|.|.|    ..|:...|:.||.||.:::|:
  Fly   484 ISGGVINEKENTCELSKPSVFTDVAKHIEWV 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/258 (28%)
Tryp_SPc 123..359 CDD:238113 72/259 (28%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 75/272 (28%)
Tryp_SPc 277..514 CDD:214473 74/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.