DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG8870

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:355 Identity:98/355 - (27%)
Similarity:141/355 - (39%) Gaps:82/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PFSSSGSLEHDAE----------MSASNVDNRHIKGLGMGREMSALSEEDDREPLVLNLETTPLM 109
            |:|:....:.|.|          .:..|...::|.||   |....            |....|..
  Fly    19 PYSNGAGCQFDTECVNLDKCPRTRAVMNSSRKNIIGL---RRCGT------------NKVCCPKW 68

  Fly   110 EKMLPEGAMAMDR--IFGGDVGNPHCFPYQVGMLL--------QR--PKGLYWCGGSLISDKHVI 162
            |..||.......|  ...|.:...:.||: :.|||        |:  ||    ||||||::.:|:
  Fly    69 ETYLPHDTCGQSRRKPTKGKIPALNEFPW-MAMLLYGNKNNLSQKLVPK----CGGSLINNWYVL 128

  Fly   163 TAAHCVDMA----KRAL--VFLGANEIKNAKEKG---------------QVRLMVPSENFQIYPT 206
            ||||||:..    ..||  |.||.:......::.               :|..::..|.|.    
  Fly   129 TAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFN---- 189

  Fly   207 WNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLR 271
             ..:||.:|||:|||...|.:...|.||.|| |..:..:.|.|.. ||||.....|:  .|.||.
  Fly   190 -RGRRLINDIALVRLKFPVRYTRAIQPICLP-RAQKLAAHKRKFQ-ASGWPDMGQGI--ASEVLL 249

  Fly   272 YVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLV--LQRRHSKKRVLVGITSFG 334
            ...:.......||||:..:. |:.||..|.:...|..|||||||:  :.|.........||.|:|
  Fly   250 RSFIAERHPDVCKSNYDFNL-GSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYG 313

  Fly   335 S----IYGCDRGYPAAFTKVASYLDWISDE 360
            .    :..|.   ||.:||.:.:.:||..:
  Fly   314 QKPCVLKTCK---PAFYTKTSYFFEWIKSK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 82/273 (30%)
Tryp_SPc 123..359 CDD:238113 83/272 (31%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 82/264 (31%)
Tryp_SPc 93..337 CDD:214473 80/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.