DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and snk

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:125/276 - (45%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IFGGDVGNPHCFPYQVGMLLQRPKG-----LYW-CGGSLISDKHVITAAHCVDMAKRA--LVFLG 179
            |.||.......||:...:...:..|     :.| |||:|:|:.:|:|||||.....:.  :|.||
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGSKPPDMVRLG 250

  Fly   180 ANEIKNAKEKGQ-VRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPI---QLPKRH 240
            |.::.......| :::::    ..::|.:.......|||:::|...|.|:|::.|.   |||:  
  Fly   251 ARQLNETSATQQDIKILI----IVLHPKYRSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPE-- 309

  Fly   241 YEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGR---- 301
                 .:....:|:|||| ...:.|.||.||.|.|.::...|||..:....|.......|:    
  Fly   310 -----LQIPTVVAAGWGR-TEFLGAKSNALRQVDLDVVPQMTCKQIYRKERRLPRGIIEGQFCAG 368

  Fly   302 ---NARSTCNGDSGGPL-VLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETG 362
               ..|.||.||||||: .|...::....:|||||||........ |..:|::.||||||     
  Fly   369 YLPGGRDTCQGDSGGPIHALLPEYNCVAFVVGITSFGKFCAAPNA-PGVYTRLYSYLDWI----- 427

  Fly   363 VSAHQDTTEAIFFDQY 378
                    |.|.|.|:
  Fly   428 --------EKIAFKQH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 75/253 (30%)
Tryp_SPc 123..359 CDD:238113 77/255 (30%)
snkNP_001097766.1 CLIP 93..139 CDD:197829
Tryp_SPc 186..430 CDD:238113 78/269 (29%)
Tryp_SPc 186..427 CDD:214473 75/253 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.