DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG13318

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:255 Identity:72/255 - (28%)
Similarity:113/255 - (44%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRL---- 194
            :|:|..:|  ....:|..||:||:.:||:||||.|       ..||....|       |||    
  Fly   174 YPWQAALL--TTADVYLGGGALITAQHVLTAAHKV-------YNLGLTYFK-------VRLGEWD 222

  Fly   195 ------MVPSE-----NFQIYPTWNPKRLKDDIAIVRLPHAVSFNER--IHPIQLPKRHYEYRSF 246
                  .:|::     |..:.|::||..|::|:||::|...||...:  :..:.||.     .||
  Fly   223 AASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPT-----TSF 282

  Fly   247 KNKLAIASGWGRY---ATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN--------ICTSG 300
            ..:....:|||:.   |||  |...:.|.|.:.:|....|::....:..|::        ||..|
  Fly   283 VGQRCWVAGWGKNDFGATG--AYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGG 345

  Fly   301 RNARSTCNGDSGGPLVLQRRHSKKRV--LVGITSFGSIYGC-DRGYPAAFTKVASYLDWI 357
            ...:..|.||.|.|||.    :...|  :||:.::|  .|| ..|.|..:..|.:||.||
  Fly   346 EAGKDACTGDGGSPLVC----TSNGVWYVVGLVAWG--IGCAQAGVPGVYVNVGTYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 70/253 (28%)
Tryp_SPc 123..359 CDD:238113 72/255 (28%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 72/255 (28%)
Tryp_SPc 169..399 CDD:214473 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.