DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Mcpt8l2

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001128482.1 Gene:Mcpt8l2 / 408240 RGDID:1302938 Length:248 Species:Rattus norvegicus


Alignment Length:258 Identity:72/258 - (27%)
Similarity:111/258 - (43%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MLP---EGAMAMDRIFGGDVGNPHCFPYQVGMLL----QRPKGLYWCGGSLISDKHVITAAHCVD 169
            :||   ||.    .|..|....||..||...:..    ..|:.   |||.|::...|:|||||  
  Rat    11 VLPVNTEGG----EIIWGTESKPHSRPYMAFIKFYDSNSEPQS---CGGFLVAKDIVMTAAHC-- 66

  Fly   170 MAKRALVFLGANEIKNAKEKGQVRLMV---PSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERI 231
            ..:...|.|||:.|:. :|..||..:|   |.||:..:..:|      ||.:::|......|..:
  Rat    67 NGRNIKVTLGAHNIRK-RENTQVISVVKAKPHENYDKHSRFN------DIMLLKLERKAQLNGAV 124

  Fly   232 HPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGT-N 295
            ..|.||:.....:  ..::...:|||..|....  ||.|:.|.|::..|:.|: :....|..: .
  Rat   125 KTIALPRSQDWVK--PGQVCTVAGWGHLANCTS--SNTLQEVNLEVQKGQKCQ-DMSKDYNDSIQ 184

  Fly   296 ICTSG-RNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
            :|... :..::|...|||||.|..      .|..||.|...   |....|..||:::|::.||
  Rat   185 LCVGNPKEGKATSERDSGGPFVCD------GVAQGIVSRCL---CTGTLPRVFTRISSFIPWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 66/243 (27%)
Tryp_SPc 123..359 CDD:238113 68/244 (28%)
Mcpt8l2NP_001128482.1 Tryp_SPc 20..238 CDD:214473 66/243 (27%)
Tryp_SPc 21..241 CDD:238113 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.