DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and MP1

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:293 Identity:80/293 - (27%)
Similarity:131/293 - (44%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMLPE----GAMAMDRIFGGDVGNPHCFPYQVGMLLQRP---KGLYWCGGSLISDKHVITAAHCV 168
            |:||.    |....||:.||:......||:...:...:|   || :.||||||:.::|:||||||
  Fly   122 KLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKG-HHCGGSLINHRYVLTAAHCV 185

  Fly   169 -----------------DMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQI--------YPTWN 208
                             |.:......:|.|..::..|        |..::.:        || .|
  Fly   186 SAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNE--------PYVDYPVEERIPHPQYP-GN 241

  Fly   209 PKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRS-FKNKLAIASGWGRYATGVHAISNVLRY 272
            .:...:|||::||...|.:::.|.|:.||....::.: |..:..:.:||||  |..:..||:...
  Fly   242 SRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGR--TETNFTSNIKLK 304

  Fly   273 VQLQIIDGRTCKSNFPLSYRGT---NICTSGRNARSTCNGDSGGPLVLQ--RRHSKKRVLVGITS 332
            .:|..:....|...:....|..   .:|..|.....:|.|||||||:|:  ...:....:.|:.|
  Fly   305 AELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVS 369

  Fly   333 FGSIYGCDRGYPAAFTKVASYLDWISDETGVSA 365
            :|......:|:|..:|:|.:||:||  |..|.|
  Fly   370 YGPTPCGLKGWPGVYTRVEAYLNWI--ENNVRA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 70/268 (26%)
Tryp_SPc 123..359 CDD:238113 71/269 (26%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 70/268 (26%)
Tryp_SPc 138..397 CDD:238113 72/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.