DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG18223

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:273 Identity:61/273 - (22%)
Similarity:114/273 - (41%) Gaps:62/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 YQVGMLLQRPKGLY----WCGGSLISDKHVITAAHCVDMAKRALVFLG---------ANEIKNAK 187
            |.|.:..:||..|:    :|||.:||..:::|:|||. |.||.:|...         .|.:|:.|
  Fly    60 YVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCA-MDKRKIVHRSRVLVVVAGTTNRLKSRK 123

  Fly   188 EKG---QVRLMVPSENFQIYPTWN------PKRLKDD---IAIVRLPHAVSFNERIHPIQLPKRH 240
            ...   :|:.:...:.|.::.|.|      .|:|..|   :.::.||.|.           |:..
  Fly   124 GLSLNMEVKKIFVPDKFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTAD-----------PEPG 177

  Fly   241 YEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRN--- 302
            ..|        ...||||...|....|::| ::.::::....|:....: ::...:|....|   
  Fly   178 LNY--------TVLGWGRIFKGGPLASDIL-HIDVELLPRDICEKKVHI-FKEEMMCAGNLNNTM 232

  Fly   303 ARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGC-DRGYPAAFTKVASYLDWISDETGVSAH 366
            ..:.|.||:|.||:.      ...:.|:.|:.  .|| .:..|:.:|.|..::|||:   |:..:
  Fly   233 DENPCAGDTGSPLIF------NETVFGVVSYR--VGCGSKTLPSIYTNVYMHMDWIN---GIMNN 286

  Fly   367 QDTTEAIFFDQYV 379
            .:.....:...|:
  Fly   287 NEANRLCYSPNYL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 57/249 (23%)
Tryp_SPc 123..359 CDD:238113 59/251 (24%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 59/255 (23%)
Tryp_SPc 60..280 CDD:214473 57/249 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.