DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG18180

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:272 Identity:91/272 - (33%)
Similarity:139/272 - (51%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PLVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRP---KGLYWCGGSLISDK 159
            |..||..|      :|.:||..  ||..|........||.||:.::..   .|... .|::|::.
  Fly    19 PTGLNRTT------LLSQGAEG--RIVNGYPAPEGKAPYIVGLFIRTDGSNSGAVG-AGTIIAND 74

  Fly   160 HVITAAHCV--DMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLP 222
            .::|||||:  |..:   :..|:|...|    |..|..|..:||..:|.| |.:...||.::|.|
  Fly    75 WILTAAHCLTGDYVE---IHYGSNWGWN----GAYRQTVRRDNFISHPDW-PSQGGRDIGLIRTP 131

  Fly   223 HAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNF 287
            | |.||..|:.|.||..:.:...:::...:|.|||....|  .:::.|:.|.:|||....|:..:
  Fly   132 H-VDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNG--NLADWLQCVDVQIISNSECEQAY 193

  Fly   288 PLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVAS 352
            . |...|::||...:.:|.|.||||||||   .|...| |||:.:|.|: .|..| |:.:|:|:.
  Fly   194 G-SVASTDMCTRHADGKSVCGGDSGGPLV---THDNAR-LVGVITFASV-SCHDG-PSGYTRVSD 251

  Fly   353 YLDWISDETGVS 364
            ||:||.|:||:|
  Fly   252 YLEWIRDQTGIS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 78/239 (33%)
Tryp_SPc 123..359 CDD:238113 79/240 (33%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 78/239 (33%)
Tryp_SPc 36..259 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470964
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.