DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG18179

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:265 Identity:89/265 - (33%)
Similarity:135/265 - (50%) Gaps:26/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWC---GGSLISDKHVITAAH 166
            |:.|.:..:.|||..  ||..|........||.||:|: |..|....   .|::|:...::||||
  Fly    24 TSLLPQVTISEGAEG--RIVNGYPAPEGKAPYIVGLLI-RTDGSNSAAVGAGTIIASDWILTAAH 85

  Fly   167 CV--DMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNE 229
            |:  |..:   :..|:|...|    |..|..|..:||..:|.| |.....||.::|.| :|.|.:
  Fly    86 CLTTDYVE---IHYGSNWGWN----GAFRQSVRRDNFISHPNW-PAEGGRDIGLIRTP-SVGFTD 141

  Fly   230 RIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGT 294
            .|:.:.||....|...|.:...:|.|||....|  .:::.|:.:.:|||....|:.::. :...|
  Fly   142 LINKVALPSFSEESDRFVDTWCVACGWGGMDNG--NLADWLQCMDVQIISNSECEQSYG-TVAST 203

  Fly   295 NICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISD 359
            ::||...:.:|:|.||||||||   .|...| |||:.:|||: .|..| |:.:|:|..||.||.|
  Fly   204 DMCTRRTDGKSSCGGDSGGPLV---THDNAR-LVGVITFGSV-DCHSG-PSGYTRVTDYLGWIRD 262

  Fly   360 ETGVS 364
            .||:|
  Fly   263 NTGIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 78/239 (33%)
Tryp_SPc 123..359 CDD:238113 79/240 (33%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 78/239 (33%)
Tryp_SPc 40..263 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470980
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.