DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:97/264 - (36%)
Similarity:131/264 - (49%) Gaps:26/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 TTPLM--EKMLPEGAMAMD-RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAH 166
            |.|.:  ||:.|.....|. ||..|........||.||:..   .|.:|||||:|:...|:||.|
  Fly    19 TMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGF---SGGWWCGGSIIAHDWVLTAEH 80

  Fly   167 CVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERI 231
            |:..|....|:.||....||    |....|.:.||       .|....|||::|:|| |.|...:
  Fly    81 CIGDADSVTVYFGATWRTNA----QFTHWVGNGNF-------IKHSSADIALIRIPH-VDFWHMV 133

  Fly   232 HPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNI 296
            :.::||..:..|..:....|:|.|||....| ..:.:.|:.|.||||....|...:  ...|.||
  Fly   134 NKVELPSYNDRYNDYNEWWAVACGWGGTYDG-SPLPDYLQCVDLQIIHNSECSGYY--GSVGDNI 195

  Fly   297 -CTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDE 360
             |....:.:|||.||||||||   .|...: |||:|:|||:.||..|.||.|.:|..:||||.|.
  Fly   196 LCVRTPDGKSTCGGDSGGPLV---THDGTK-LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDH 256

  Fly   361 TGVS 364
            ||::
  Fly   257 TGIA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 86/235 (37%)
Tryp_SPc 123..359 CDD:238113 87/236 (37%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 86/235 (37%)
Tryp_SPc 40..256 CDD:238113 87/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471008
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.