DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:255 Identity:92/255 - (36%)
Similarity:128/255 - (50%) Gaps:22/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRAL 175
            |.|.:.|....||..|........||.||:..   .|.:|||||:||::.|:||.||:. .....
  Fly    25 KDLSKVAKIEGRITNGYPAEEGKAPYTVGLGF---SGGWWCGGSIISNEWVLTAEHCIG-GDAVT 85

  Fly   176 VFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRH 240
            |:.||....||    |....|.|.||..:.:       .|||::|:|| |.|...::.::||..:
  Fly    86 VYFGATWRTNA----QFTHWVGSGNFITHGS-------ADIALIRIPH-VDFWHMVNKVELPSYN 138

  Fly   241 YEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN-ICTSGRNAR 304
            ..|..:....|:|.|||....| ..:.:.|:.|.||||....|.|.:.....|.| ||....:.:
  Fly   139 DRYNDYNEWWAVACGWGGTYDG-SPLPDYLQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGK 202

  Fly   305 STCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVS 364
            .||.||||||||   .|...: |||:|::.|..||..|:||.|.:|..:||||.|.||::
  Fly   203 GTCGGDSGGPLV---THDGSK-LVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIRDHTGIA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 84/235 (36%)
Tryp_SPc 123..359 CDD:238113 85/236 (36%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 84/235 (36%)
Tryp_SPc 37..254 CDD:238113 85/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471016
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.