DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and sphinx2

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:276 Identity:71/276 - (25%)
Similarity:124/276 - (44%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LVLNLETTPLME--KMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRP--KGLYWCGGSLISDK 159
            |||:| |..:.|  |:.|       ||.||....|:...|.||::..:.  ..|.:..|::||::
  Fly     8 LVLSL-TFSVCEKNKLSP-------RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQ 64

  Fly   160 HVITAAHCVDMAKRALVFLGANEIKNAKEK--GQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLP 222
            .::|       .|..|:|........:|..  |...|.:..|||  |..::..|:   ||:|:.|
  Fly    65 WILT-------VKEVLIFKYIEAHFGSKRAFWGYDILRIYRENF--YFHYDKTRI---IALVKCP 117

  Fly   223 HAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTC-KSN 286
            :. .|:.|:..:::|.....:..:...:.:..|||.....|. :...:|.|::::::...| |.:
  Fly   118 YQ-KFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVR-LPTWMRCVEVEVMNNTECAKYH 180

  Fly   287 FPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIY----GCDRGYPAAF 347
            .||.:  ..:||||...:..|.||.||.:|....:.        |..|.|:    .|..|||:..
  Fly   181 TPLKW--YEMCTSGEGFKGVCEGDMGGAVVTMGPNP--------TFIGIIWLMPTNCSIGYPSVH 235

  Fly   348 TKVASYLDWISDETGV 363
            .:|:.::.||...:||
  Fly   236 IRVSDHIKWIKHVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 59/243 (24%)
Tryp_SPc 123..359 CDD:238113 60/244 (25%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 59/243 (24%)
Tryp_SPc 26..248 CDD:304450 60/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.