DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG10469

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:280 Identity:86/280 - (30%)
Similarity:130/280 - (46%) Gaps:44/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLL------QRPKGLYWCGGSLIS 157
            ||...||..|             ||..|........|||||:|.      ..|.   .|||:::|
  Fly    13 LVFGQETGSL-------------RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPN---MCGGTILS 61

  Fly   158 DKHVITAAHCVDMAKRAL--VFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVR 220
            ::.:||||||:...|..|  |.:...::|:..:|   .::|......::..::.|.:.:|||:::
  Fly    62 NRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDK---EIVVNRSYTIVHKKFDRKTVTNDIALIK 123

  Fly   221 LPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKS 285
            ||..::||:.|.|.:||...   :::..:.||.||||  .|.....|.||:|::..||..:.|:.
  Fly   124 LPKKLTFNKYIQPAKLPSAK---KTYTGRKAIISGWG--LTTKQLPSQVLQYIRAPIISNKECER 183

  Fly   286 NFPLSYRGTN--------ICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRG 342
            .:.....|.:        ||...:.. ..|.||||||:||.   ...|.||||.|.|....|...
  Fly   184 QWNKQLGGKSKKVVHNGFICIDSKKG-LPCRGDSGGPMVLD---DGSRTLVGIVSHGFDGECKLK 244

  Fly   343 YPAAFTKVASYLDWISDETG 362
            .|...|:|:|||.||...:|
  Fly   245 LPDVSTRVSSYLKWIKYYSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 78/250 (31%)
Tryp_SPc 123..359 CDD:238113 79/251 (31%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 78/250 (31%)
Tryp_SPc 24..260 CDD:238113 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470683
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.