DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG6462

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:261 Identity:93/261 - (35%)
Similarity:139/261 - (53%) Gaps:9/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 EKMLPEG---AMAMDRIFGGDVGNPHCFPYQVGMLLQ-RPKGLYWCGGSLISDKHVITAAHCVDM 170
            ||...||   |....||.||::.....||||||:::| ....|..||||||:.:.|:|||||:..
  Fly    61 EKFEMEGNQTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTD 125

  Fly   171 AKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQ 235
            |..|.::.||....:.::..: .|.|...:|.|||.:.......|:|::|||..|..:|::.||:
  Fly   126 AIAAKIYTGATVFADVEDSVE-ELQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIE 189

  Fly   236 LPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNF--PLSYRGTNICT 298
            |............|:...||||.........:.:|:|:..::||...|...|  .|..:..::||
  Fly   190 LAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCT 254

  Fly   299 SGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGV 363
            .|.|.|..||||||||:|...|:..  .|:|:|||||..||:.|.|..:|::.:||.||..:|.:
  Fly   255 DGSNGRGACNGDSGGPVVYHWRNVS--YLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQQTAM 317

  Fly   364 S 364
            :
  Fly   318 T 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 85/237 (36%)
Tryp_SPc 123..359 CDD:238113 86/238 (36%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 85/237 (36%)
Tryp_SPc 77..314 CDD:238113 86/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
54.920

Return to query results.
Submit another query.