DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and yip7

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:231 Identity:90/231 - (38%)
Similarity:132/231 - (57%) Gaps:12/231 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPS 198
            ||||||:......|.:|||||:|.::.|:|||||.|.|....::.||. ::.:.|..||   |.|
  Fly    51 FPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGAT-VRTSPEFTQV---VSS 111

  Fly   199 ENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGV 263
            ..|:.:.::....:::||:::: ..:|||:..::.|.||.....|.:::.|.|:|||||..:...
  Fly   112 SKFRQHESYLALTIRNDISLIQ-TSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQA 175

  Fly   264 HAISNVLRYVQLQIIDGRTCKSNF-PLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVL 327
            .|:|..|:||.|.||....|:..| .|......:|....|..|||.|||||||.|.      .||
  Fly   176 TAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALD------GVL 234

  Fly   328 VGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGV 363
            :|.|||||..||:.|.|||||::..|.|||.:.:|:
  Fly   235 IGATSFGSADGCESGAPAAFTRITYYRDWIKETSGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 87/223 (39%)
Tryp_SPc 123..359 CDD:238113 89/225 (40%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 87/223 (39%)
Tryp_SPc 40..267 CDD:238113 89/226 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470956
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.