DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG30283

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:272 Identity:76/272 - (27%)
Similarity:123/272 - (45%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVIT 163
            :||..|:...:|.......::..:|.||........|:   |.:...:|.:.|||:||:::.|:|
  Fly    19 VVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPW---MAMVMGEGGFHCGGTLITNRFVLT 80

  Fly   164 AAHCVDMAKRAL-VFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSF 227
            :|||:  |...| |.||..|.:...:|..|..|....::...        :.|:|::||...|.:
  Fly    81 SAHCI--ANGELKVRLGVLEREAEAQKFAVDAMFVHTDYYFD--------QHDLALLRLAKRVHY 135

  Fly   228 NERIHPI---------QLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTC 283
            ::.|.||         .:.:...::|::        |||:  |...:.|.:|:...|..:....|
  Fly   136 SDNISPICLLLDPLVKNIDEHIVKFRTY--------GWGK--TESRSSSRMLQKTSLFNLHRSEC 190

  Fly   284 KSNFPLSYRGTN-ICTSGRNARSTCNGDSGGPL--VLQRRHSKKRVLVGITSFGSIYGCDRGYPA 345
            ...:|......| ||....|| :||||||||||  ::...|.:.....|:||||.   .|.....
  Fly   191 AKQYPHQQINRNHICAESANA-NTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGH---ADCSKAT 251

  Fly   346 AFTKVASYLDWI 357
            .||.|.::||||
  Fly   252 VFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 70/247 (28%)
Tryp_SPc 123..359 CDD:238113 72/248 (29%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 70/247 (28%)
Tryp_SPc 43..266 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.