DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Prss48

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:264 Identity:73/264 - (27%)
Similarity:118/264 - (44%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRAL---VFLGANE- 182
            ||.||.......:|:||.:   |....:.||||||||..|:|||||:.....:.   |:||:.: 
Mouse    39 RIVGGQDAALGRWPWQVSL---RFDYTHSCGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGSIDR 100

  Fly   183 --IKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRS 245
              ....||....|:.:|.::         :..:.|||:::|...|:|:..|.||.||       :
Mouse   101 EYSSTGKEYYVSRIAIPDKH---------RHTEADIALLKLSSRVTFSSVILPICLP-------N 149

  Fly   246 FKNKLAI-----ASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNF-PLS---------YRGTN 295
            ...:|.:     .:|||:...|.:  .:.|:.:::.:|....|:..: |:.         .:...
Mouse   150 ISKQLTVPASCWVTGWGQNQEGHY--PSTLQELEVPVISSEACEQLYNPIGVFLPDLERVIKEDM 212

  Fly   296 ICTSGRNAR-STCNGDSGGPLV-----LQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYL 354
            .|...|.:| .:|.|||||||.     :.|       |:|:.|:|  ..|.:..|..:|.|..|.
Mouse   213 FCAGERQSRKDSCKGDSGGPLSCHIDGVWR-------LMGVVSWG--LECGKDLPGVYTNVTYYQ 268

  Fly   355 DWIS 358
            .|||
Mouse   269 KWIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 70/261 (27%)
Tryp_SPc 123..359 CDD:238113 72/263 (27%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 70/261 (27%)
Tryp_SPc 40..274 CDD:238113 72/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.