DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and PRSS41

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:295 Identity:81/295 - (27%)
Similarity:126/295 - (42%) Gaps:44/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GMGREMSALSEEDDREPLVLNLETTPLMEKMLPE--GAMAMDRIFGGDVGNPH-CFPYQVGMLLQ 143
            |.|||...|...:.:|            |::|.|  |...:..:..|.|.:.. .:|:|..:.|:
Human    39 GGGREGHFLCPAESQE------------EELLSEACGHREIHALVAGGVESARGRWPWQASLRLR 91

  Fly   144 RPKGLYWCGGSLISDKHVITAAHCVD---MAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYP 205
            |   .:.|||||:|.:.|::||||..   ......|.||  |:.:......:|..  |..:::..
Human    92 R---RHRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLG--ELTSRPTPWNLRAY--SSRYKVQD 149

  Fly   206 -TWNPKR---LKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYA---TGV 263
             ..||..   |::|||::||..:|::|..|.||.:....:.:  ........:|||..:   |.:
Human   150 IIVNPDALGVLRNDIALLRLASSVTYNAYIQPICIESSTFNF--VHRPDCWVTGWGLISPSGTPL 212

  Fly   264 HAISNVLRYVQLQIIDGRTCKSNF--PLSYR---GTNICTSGRNAR-STCNGDSGGPLVLQRRHS 322
            ....| ||..|:.|::...|...|  |.|..   .:..|....:.. .||.||||||||..:  .
Human   213 PPPYN-LREAQVTILNNTRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDK--D 274

  Fly   323 KKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
            .....|||.|:|...| ....|..:|.::.|..||
Human   275 GLWYQVGIVSWGMDCG-QPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 69/251 (27%)
Tryp_SPc 123..359 CDD:238113 71/252 (28%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.