DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and try-9

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:259 Identity:63/259 - (24%)
Similarity:98/259 - (37%) Gaps:62/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GSLISDKHVITAAHCVDMAK-----------RALVFLGANEIKNAKEKGQVRLMVPS--ENFQIY 204
            |:|:|..|::||||.:.:::           |...|:  .:.||......|...||.  :.....
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFV--RDYKNFVAFVNVTCAVPEMCKGLHRK 92

  Fly   205 PTWNPKRLK-------------------DDIAIVRLPHAVSFNERIHPIQLPK-------RHYEY 243
            ..:.|..:|                   :|||:..|...:.|::.|.|..||.       |...|
 Worm    93 DMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGY 157

  Fly   244 RSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCN 308
            :.|        |:||..:.....|..|:.:...:.:   |..:||  |.|. .|||..|...:|:
 Worm   158 KLF--------GYGRDPSDSVLESGKLKSLYSFVAE---CSDDFP--YGGV-YCTSAVNRGLSCD 208

  Fly   309 GDSGGPLVLQRRHSKKRVLVGITSFG----SIYGCDRGYPAAFTKVASYLDWISDETGVSAHQD 368
            ||||..:|........:||||:.|.|    .:|...........::....|.:.|   ||||.|
 Worm   209 GDSGSGVVRTSDTRNVQVLVGVLSAGMPCPELYDTHNRQRQQRRQLTQETDLLVD---VSAHVD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 57/246 (23%)
Tryp_SPc 123..359 CDD:238113 57/248 (23%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 55/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.