DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Prss33

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:259 Identity:81/259 - (31%)
Similarity:121/259 - (46%) Gaps:43/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRA-----LVFLGA- 180
            ||.||.......:|:|..:   :.:|.:.||||||:.:.|:||.||  ..:|.     .|.||| 
Mouse    97 RIVGGRDAQDGEWPWQTSI---QHRGAHVCGGSLIAPQWVLTAGHC--FPRRVWPSEYSVLLGAL 156

  Fly   181 -NEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPK--RHYE 242
             .:::::.|     |:||.....:.|.::....:.|:|:::|.|.||.:.||.|:.||.  .|..
Mouse   157 SLDVRSSHE-----LLVPVLRVLLPPDYSEDEARGDLALLQLRHPVSLSTRIQPVCLPAPGSHPP 216

  Fly   243 YRSFKNKLAIASGWGRYATGVH-AISNVLRYVQLQIIDGRTCK------SNFPLSYR---GTNIC 297
                .......:|||..:.||. .....|:.|::.::|.|.|.      :|.|...|   ..|:|
Mouse   217 ----PGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHVGANVPQGERIVLPGNLC 277

  Fly   298 TSGRNA-RSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGC---DRGYPAAFTKVASYLDWI 357
            ...|.. :..|.|||||||...  .|...||||:.|:|.  ||   :|  |..:|.||.|..||
Mouse   278 AGYRRGHKDACQGDSGGPLTCM--ESGHWVLVGVVSWGK--GCALPNR--PGVYTNVAKYSPWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 79/257 (31%)
Tryp_SPc 123..359 CDD:238113 80/258 (31%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 80/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.