DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG4650

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:347 Identity:81/347 - (23%)
Similarity:143/347 - (41%) Gaps:85/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LPEGAMAMDRIFG----GDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKR 173
            :|..:..:|...|    |.:.|....|:..  .|...:.||.|||::|::|.|:|||||...:::
  Fly    17 VPGSSQYLDGRCGLLTNGKIANNISSPWMA--YLHTSELLYVCGGTVITEKLVLTAAHCTRASEQ 79

  Fly   174 ALV----FLGANEIKNAK-EKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHP 233
            .:.    |:|.::..:.. .:.||     |:.| |:..:|.....:||||:.|...:.|::.|.|
  Fly    80 LVARIGEFIGTDDANDTMLSEYQV-----SQTF-IHSLYNTTTSANDIAILGLATDIVFSKTIRP 138

  Fly   234 IQLPKRHYEYRSFKNKLAIASG--WG----RYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYR 292
            |.:..... :|.:.:.:.:.||  ||    |..:....|:::.|.           .:|...:..
  Fly   139 ICIVWWTI-WRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQ-----------PANMCSTLN 191

  Fly   293 GTNICTS----GRNARSTCNGDSGGPL--VLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVA 351
            ||.|.:|    |.:....||.|...||  ::..::.::.||:||.:...  .|.|.  :.:|.|.
  Fly   192 GTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQ--KCKRA--SVYTDVL 252

  Fly   352 SYLDWISDETGVSAHQDTTEAIFFDQYVREYGKPRQSRRLETEEQLEDDVPDELDVHPRPASDED 416
            |:.|:|.                  ...|:|....:|.:..       |:.:..||         
  Fly   253 SHTDFIL------------------SVWRQYRNGEKSPKTW-------DLQNNFDV--------- 283

  Fly   417 ISENVRPRTRSRPHSEHEFYFL 438
              ||    |..:.:||.|.||:
  Fly   284 --EN----TTLKANSEEEHYFV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 64/255 (25%)
Tryp_SPc 123..359 CDD:238113 65/256 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 63/248 (25%)
Tryp_SPc 33..258 CDD:304450 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.