DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:258 Identity:96/258 - (37%)
Similarity:132/258 - (51%) Gaps:22/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRAL 175
            |.||:......||..|........||.||:... ..|.:|||||:|:...|:|||||.:.|.:..
  Fly    25 KDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFS-GNGGWWCGGSIIAHDWVLTAAHCTNGASQVT 88

  Fly   176 VFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRH 240
            ::.||....||    |....|.|.:|.....| |.:..:|||::|.|| |.|...::.::||..:
  Fly    89 IYYGATWRTNA----QFTHTVGSGDFIQNHNW-PNQNGNDIALIRTPH-VDFWHMVNKVELPSFN 147

  Fly   241 YEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN----ICTSGR 301
            ..|..:.|..|:|.|||....|  :..:.:..|.||||....|...:     ||.    :|.|..
  Fly   148 DRYNMYDNYWAVACGWGLTTAG--SQPDWMECVDLQIISNSECSRTY-----GTQPDGILCVSTS 205

  Fly   302 NARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVS 364
            ..:|||:|||||||||   |...| |||:||:.|..||..|.|:.||:|.:.||||.|.:||:
  Fly   206 GGKSTCSGDSGGPLVL---HDGGR-LVGVTSWVSGNGCTAGLPSGFTRVTNQLDWIRDNSGVA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 88/238 (37%)
Tryp_SPc 123..359 CDD:238113 89/239 (37%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 88/238 (37%)
Tryp_SPc 37..260 CDD:238113 89/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470940
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
87.950

Return to query results.
Submit another query.