DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and prss60.3

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:256 Identity:83/256 - (32%)
Similarity:130/256 - (50%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPK-GLYWCGGSLISDKHVITAAHCVDMAKRA--LVFLGANEI 183
            ||.||...:|..:|:||.  |..|| |.::|||||||.:.|:|||||:......  :|:||    
Zfish    35 RIVGGVNASPGSWPWQVS--LHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLG---- 93

  Fly   184 KNAKEKGQVRLMVPSENFQ---IYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRS 245
             ...::| :.:...|.|..   ::.::|.....:|||::||..||:|...|.|:.|..::..|.:
Zfish    94 -RRTQQG-INIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSA 156

  Fly   246 FKNKLAIASGWGRYATGVH-AISNVLRYVQLQIIDGRTCKSNFPLSYRGT---NICTSG--RNAR 304
              ...:..:|||....||: ....:|:...:.::....|.:   |...||   |:..:|  :..:
Zfish   157 --GTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNA---LLGSGTVTNNMICAGLTQGGK 216

  Fly   305 STCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGC-DRGYPAAFTKVASYLDWISDETGVS 364
            .||.||||||:|  .|.....|..||||:|  ||| |...|..:|:|:.|..|||.:..::
Zfish   217 DTCQGDSGGPMV--TRLCTVWVQAGITSWG--YGCADPNSPGVYTRVSQYQSWISSKISLN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 80/247 (32%)
Tryp_SPc 123..359 CDD:238113 81/248 (33%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 82/249 (33%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.