DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and psh

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:335 Identity:88/335 - (26%)
Similarity:137/335 - (40%) Gaps:65/335 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SSSSPFSSSGSLEHDAEMSASNVDNRHIKGLGMGREMSALSEEDDREPLVLNLETTPLMEKMLPE 115
            |:.:..|:|.:....|.|::..||   :...|.|...:..:.:..||            .|....
  Fly    87 STITSVSTSSTTSTKAPMTSGRVD---VPTFGSGDRPAVAACKKIRE------------RKQQRS 136

  Fly   116 GAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGL------YWCGGSLISDKHVITAAHCV--DMAK 172
            |...:..|.||...:|..:|:...:      |.      :.||||||:.:.|:||||||  |...
  Fly   137 GNQLVIHIVGGYPVDPGVYPHMAAI------GYITFGTDFRCGGSLIASRFVLTAAHCVNTDANT 195

  Fly   173 RALVFLGANEIKNAKEKGQVRLMVPSENFQ--------IYPTWNPKRLKDDIAIVRLPHAVSFNE 229
            .|.|.|||..|:|           |..::|        |:|.:...:. :||||:.|...|...:
  Fly   196 PAFVRLGAVNIEN-----------PDHSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETD 248

  Fly   230 RIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNF---PLSY 291
            .|.|..|.....:..|  |.....:|||.......|.|.:|....|:::....|..::   |.|.
  Fly   249 NIRPACLHTDATDPPS--NSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSI 311

  Fly   292 R-------GTNICTSGRN-ARSTCNGDSGGPLVLQRR-HSKKRVLVGITSFGSIYGCDRGYPAAF 347
            |       .:.:|...:. ....|.|||||||:.:.. ......::|:.|.|  :||....|..:
  Fly   312 RLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSG--FGCATVTPGLY 374

  Fly   348 TKVASYLDWI 357
            |:|:||||:|
  Fly   375 TRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 74/262 (28%)
Tryp_SPc 123..359 CDD:238113 75/263 (29%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 74/262 (28%)
Tryp_SPc 144..387 CDD:238113 75/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437057
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.