DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and sphe

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:256 Identity:63/256 - (24%)
Similarity:111/256 - (43%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 AMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV-------DMAKRALV 176
            |..||.||:..:.....:...:   |....:.||||::|...::|.||||       |.::.|..
  Fly    22 AQGRIMGGEDADATATTFTASL---RVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACR 83

  Fly   177 FLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPI------- 234
            ....|:....|       :|..|:..::|.:  ..|.:::|::.|...:::.:||..|       
  Fly    84 VGSTNQYAGGK-------IVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVASGE 139

  Fly   235 QLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTS 299
            .||....|        .|.:||||.:.|.:  |..:|.:.|::....||...:. .:...:.|.:
  Fly   140 ALPAEGSE--------VIVAGWGRTSDGTN--SYKIRQISLKVAPEATCLDAYS-DHDEQSFCLA 193

  Fly   300 GRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDE 360
            ......||:||.||..:.      ...|:|:|:| .:..|...||..|.:::||.|||.::
  Fly   194 HELKEGTCHGDGGGGAIY------GNTLIGLTNF-VVGACGSRYPDVFVRLSSYADWIQEQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 60/248 (24%)
Tryp_SPc 123..359 CDD:238113 61/249 (24%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/234 (25%)
Tryp_SPc 42..244 CDD:214473 56/231 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471078
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.