DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and f2

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_005169022.1 Gene:f2 / 325881 ZFINID:ZDB-GENE-030131-4606 Length:635 Species:Danio rerio


Alignment Length:319 Identity:88/319 - (27%)
Similarity:142/319 - (44%) Gaps:58/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GMGREMSALSEEDDREPLV---------LNLETTPLMEKM----LPEGAMAM----DRIFGGDVG 129
            |.|||.:.|   |.|:...         |:....||.||:    ..|..:.|    .||.|||..
Zfish   319 GGGRERTTL---DQRKAFFNPRSFGNGELDCGERPLFEKINKADKNEKELLMSYTGSRIVGGDEA 380

  Fly   130 NPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV------------DMAKRALVFLGANE 182
            .....|:||.:..:.|:.|. ||.|||||:.::|||||:            |:    :|.||.:.
Zfish   381 EVASAPWQVMLYKRSPQELL-CGASLISDEWILTAAHCILYPPWNKNFTINDI----IVRLGKHS 440

  Fly   183 IKNAKEKGQVRLMVPSENFQIYPTWNPK-RLKDDIAIVRLPHAVSFNERIHPIQLP----KRHYE 242
             :...|:| :..:|..:...::|.:|.| .|..|||::.:...|.|...|||:.||    .::..
Zfish   441 -RTKYERG-IEKIVAIDEIIVHPKYNWKENLNRDIALLHMKKPVVFTSEIHPVCLPTKSIAKNLM 503

  Fly   243 YRSFKNKLAIASGWGR----YATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNA 303
            :..:|.::   :|||.    :.:....:..||:.:.|.|:|...|:::..:.......|...:..
Zfish   504 FAGYKGRV---TGWGNLRESWTSNPTNLPTVLQQIHLPIVDQSICRNSTSVIITDNMFCAGYQPD 565

  Fly   304 RS----TCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWI 357
            .|    .|.||||||.|::.....:...:||.|:|.  |||| |....:|.:.....|:
Zfish   566 DSKRGDACEGDSGGPFVMKSPSDNRWYQIGIVSWGE--GCDRDGKYGFYTHLFRMRRWM 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 73/260 (28%)
Tryp_SPc 123..359 CDD:238113 73/261 (28%)
f2XP_005169022.1 GLA 39..100 CDD:214503
KR 126..206 CDD:214527
KR 228..309 CDD:214527
Thrombin_light 326..373 CDD:286482 10/49 (20%)
Tryp_SPc 373..621 CDD:214473 73/259 (28%)
Tryp_SPc 374..625 CDD:238113 73/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.