DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG31269

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:259 Identity:84/259 - (32%)
Similarity:123/259 - (47%) Gaps:36/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMA--KRALVFLGANEIK 184
            ||.||........|||:.  ||...|.:.|||::|::..|:||||||:.|  ...:|..|.|  |
  Fly    37 RIIGGQAAEDGFAPYQIS--LQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTN--K 97

  Fly   185 NAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNK 249
            ..:..|:..|    :...|:..::...:.:|||::.|...::::||..||.||....:    ...
  Fly    98 YNQPGGRYFL----KAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ----PGD 154

  Fly   250 LAIASGWGRYATGVHAISNV-LRYVQLQIIDGRTCK---SNFPLSYRGTNICTSGRNARSTCNGD 310
            ..|.:|||  :|.:...|.: |:.:.||.:..|.||   ||......| :|||..|.....|:||
  Fly   155 EVILTGWG--STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG-HICTFSRLGEGACHGD 216

  Fly   311 SGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI-------SDETGVSAHQ 367
            ||||||      ....|||:.::|  :.|..|.|.....|..|.|||       |..||.|::|
  Fly   217 SGGPLV------SNGYLVGLVNWG--WPCATGVPDVHASVYFYRDWIRNVMSGNSKCTGFSSNQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 77/240 (32%)
Tryp_SPc 123..359 CDD:238113 78/248 (31%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/240 (32%)
Tryp_SPc 38..258 CDD:238113 78/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.