DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG31205

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:229 Identity:57/229 - (24%)
Similarity:97/229 - (42%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGGSLISDKHVITAAHCVDMAKRALVF---LGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRL 212
            |.|.||..:.|:||||||...:...::   .|.::..|......|         .::|.::|::.
  Fly    68 CTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAV---------TVHPDYSPRKF 123

  Fly   213 KDDIAIVRLPHAVSFNERIHPIQLPKRHYEY---RSFKNKLAIAS----GWGRYATGVHAISNVL 270
            ::|:||:.|...|.|::.:.||.||......   .:..:||.:|.    .:.|..:....:...:
  Fly   124 ENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRI 188

  Fly   271 RYVQLQIIDGRTC---KSNFPLSYRGTNICTSGRNARSTCNGD-----SGGPLVLQRRHSKKRVL 327
            :....: ||.:.|   ::.||...    ||  |...||..:|.     ||.|   ::.|     |
  Fly   189 KMTYTK-IDSKECHEKQARFPEEL----IC--GHTERSPLSGSALTEASGTP---RQFH-----L 238

  Fly   328 VGITSFGSIYGCD---RGYPAAFTKVASYLDWIS 358
            :||...| .:..|   :||    ..:..:|||||
  Fly   239 LGIAVAG-FFSSDLDHQGY----LNIRPHLDWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 54/226 (24%)
Tryp_SPc 123..359 CDD:238113 57/229 (25%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.