DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and sphinx1

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:279 Identity:62/279 - (22%)
Similarity:122/279 - (43%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LVLNLETTPLME--KMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLL--QRPKGLYWCGGSLISDK 159
            |||:| |..:.|  |:.|       ||.||.........|.||::.  .:...|.:..|::||::
  Fly     8 LVLSL-TVSVGEKNKLSP-------RIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQ 64

  Fly   160 HVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDD--IAIVRLP 222
            .::|....:..:     ::..:.......:|...:.:..|||:.:       ..:|  ||:|:.|
  Fly    65 WILTVKTVLKYS-----YIEVHLASRRSYRGFDIIRIYKENFRFH-------YDNDHVIALVKCP 117

  Fly   223 HAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWG---RYATGVHAISNVLRYVQLQIIDGRTCK 284
            :. .|:.|:..:::|.....:..:...:.:..|:|   |:|    .:...:|.:::::::...|.
  Fly   118 YQ-KFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHA----KLPEWMRCIEVEVMNNTECA 177

  Fly   285 SNF-PLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIY----GCDRGYP 344
            ..: ||.:  ..:||||...:..|.||.||.:|....:.        |..|.|:    .|..|||
  Fly   178 KYYTPLKW--YEMCTSGEGFKGVCEGDIGGAVVTMGPNP--------TFIGIIWLMPENCSIGYP 232

  Fly   345 AAFTKVASYLDWISDETGV 363
            :...:|:.::.||...:||
  Fly   233 SVHIRVSDHIKWIKRVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 50/246 (20%)
Tryp_SPc 123..359 CDD:238113 51/247 (21%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 50/246 (20%)
Tryp_SPc 26..248 CDD:304450 51/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.