DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and spirit

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:263 Identity:80/263 - (30%)
Similarity:122/263 - (46%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IFGGDVGNPHCFPYQ--VGMLLQRPKGLYW-CGGSLISDKHVITAAHCVDMAKR--ALVFLGANE 182
            :.||....|..||:.  :|......:.:|: |||:||::..|:|||||.|:...  :.|.||.:.
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly   183 IKNAK-EKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSF 246
            :...: |...:|.::      |:|.::.....:|||::.|..|..      |...|...:..:..
  Fly   197 LTLTEGEDISIRRVI------IHPDYSASTAYNDIALLELETAAK------PELKPTCIWTQKEV 249

  Fly   247 KNKLAIASGWGRYATGVHAISNV-LRYVQLQIIDGRTC-----KSNFPLSYRGTNICTSG-RNAR 304
            .|.|..|.|:|:  |....:|:. |..|.|:.:....|     |........||.:|... ...|
  Fly   250 TNTLVTAIGYGQ--TSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGER 312

  Fly   305 STCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVSAHQDT 369
            .||.|||||||::|  ......:|||||.|.  ||..|.|:.:|:|:|::|||  |..|...|..
  Fly   313 DTCQGDSGGPLLMQ--DGLLGYVVGITSLGQ--GCASGPPSVYTRVSSFVDWI--EGIVWPAQQV 371

  Fly   370 TEA 372
            |.|
  Fly   372 TNA 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 73/246 (30%)
Tryp_SPc 123..359 CDD:238113 75/248 (30%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 76/251 (30%)
Tryp_SPc 132..361 CDD:214473 73/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.