DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG11664

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:227 Identity:61/227 - (26%)
Similarity:97/227 - (42%) Gaps:46/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GMLLQRPKGLYWCGGSLISDKHVITAAHCV-------DMAKRALVFLGANEIKNAKEKGQVRLMV 196
            |.::|.....:...|||.|.::|:|.|||.       :::.||.....|.|.:..:..|.:|   
  Fly    35 GYVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLR--- 96

  Fly   197 PSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYAT 261
                   :|.::|..|::|||::|:..|:|.:..|:.|.|..|.....:........:||..   
  Fly    97 -------HPKFSPLTLRNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNL--- 151

  Fly   262 GVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRV 326
             :| |:..|:.:.:|:...:.|:..|| ...|..||.|.......|.||||.||:          
  Fly   152 -MH-IAQPLKSMSVQVEPEKNCRQWFP-QISGGVICASATMGEGLCYGDSGDPLI---------- 203

  Fly   327 LVGITSFGSIYG-------C-DRGYPAAFTKV 350
                 |.|.:.|       | |:.|||.||.|
  Fly   204 -----SGGEVCGLAIAFRKCGDKRYPALFTDV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 61/227 (27%)
Tryp_SPc 123..359 CDD:238113 61/227 (27%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 60/224 (27%)
Tryp_SPc 38..237 CDD:214473 60/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.