DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and HGF

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_000592.3 Gene:HGF / 3082 HGNCID:4893 Length:728 Species:Homo sapiens


Alignment Length:292 Identity:74/292 - (25%)
Similarity:120/292 - (41%) Gaps:72/292 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EDDREPLVLNLETTPLME----KMLPEGAMAMDRIFGG-----DVGNPHCFPYQVGMLLQRPKGL 148
            |.|..|.::||: .|::.    |.|        |:..|     ::|         .|:..|.:..
Human   470 EGDTTPTIVNLD-HPVISCAKTKQL--------RVVNGIPTRTNIG---------WMVSLRYRNK 516

  Fly   149 YWCGGSLISDKHVITAAHCV---DMAKRALVFLGANEI-----KNAKEKGQVRLMVPSENFQIYP 205
            :.||||||.:..|:||..|.   |: |....:||.:::     :..|:...|..:|         
Human   517 HICGGSLIKESWVLTARQCFPSRDL-KDYEAWLGIHDVHGRGDEKCKQVLNVSQLV--------- 571

  Fly   206 TWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVL 270
             :.|:  ..|:.:::|......::.:..|.||  :|.....:.......|||  .||:.....:|
Human   572 -YGPE--GSDLVLMKLARPAVLDDFVSTIDLP--NYGCTIPEKTSCSVYGWG--YTGLINYDGLL 629

  Fly   271 RYVQLQIIDGRTCKSNFPLSYRG------TNICTSGRNARS-TCNGDSGGPLVLQRRHSKKRVLV 328
            |...|.|:....|..:    :||      :.||.......| .|.||.|||||.::.  |.|:::
Human   630 RVAHLYIMGNEKCSQH----HRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQH--KMRMVL 688

  Fly   329 GITSFGSIYGC---DRGYPAAFTKVASYLDWI 357
            |:...|.  ||   :|  |..|.:||.|..||
Human   689 GVIVPGR--GCAIPNR--PGIFVRVAYYAKWI 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 64/257 (25%)
Tryp_SPc 123..359 CDD:238113 65/258 (25%)
HGFNP_000592.3 PAN_APPLE 39..122 CDD:238074
KR 126..208 CDD:214527
KR 210..290 CDD:214527
KR 304..384 CDD:214527
KR 388..470 CDD:238056 74/292 (25%)
Tryp_SPc 494..716 CDD:214473 64/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.