DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and F12

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001014028.1 Gene:F12 / 306761 RGDID:1359175 Length:603 Species:Rattus norvegicus


Alignment Length:304 Identity:86/304 - (28%)
Similarity:133/304 - (43%) Gaps:57/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 MSALSEEDDREPLVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYW- 150
            :|...:...|...|::..:|.:..:...:...::.|:.||.|..|...||..        .||| 
  Rat   326 LSDALDNSTRNQNVVSRTSTVVCGQRFRKRLSSLRRVVGGLVALPGSHPYIA--------ALYWG 382

  Fly   151 ---CGGSLISDKHVITAAHCVD---MAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNP 209
               |.||||....|:|||||:.   ..:...|.||.:....:.|:.|. |.|.|  ::::..::.
  Rat   383 DSFCAGSLIDPCWVLTAAHCLQKRPAPEELTVVLGQDRHNQSCERCQT-LAVHS--YRLHEGFSS 444

  Fly   210 KRLKDDIAIVRL-----------PHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGV 263
            |..:.|:|::||           ||       :.|:.||..  .....:..|...:|||....|.
  Rat   445 KTYQHDLALLRLRGRKNSCAILSPH-------VQPVCLPSS--AAPPSETVLCEVAGWGHQFEGA 500

  Fly   264 HAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNI-----CT----SGRNARSTCNGDSGGPLVLQR 319
            ...:..|:..|:..|....|.|:   :..|..|     |.    .|.:|   |.||||||||...
  Rat   501 EEYATFLQEAQVPFISLDRCSSS---NVHGDAILPGMLCAGFLEGGADA---CQGDSGGPLVCDE 559

  Fly   320 RHSKKRV-LVGITSFGSIYGC-DRGYPAAFTKVASYLDWISDET 361
            ..::::: |.|:.|:||  || ||..|..:|.||:|||||.:.|
  Rat   560 GVTERQLTLRGVISWGS--GCGDRNKPGVYTDVANYLDWIQEHT 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 79/263 (30%)
Tryp_SPc 123..359 CDD:238113 80/264 (30%)
F12NP_001014028.1 FN2 40..87 CDD:238019
EGF_CA 95..130 CDD:238011
FN1 132..170 CDD:238018
EGF 177..207 CDD:278437
Kringle 216..294 CDD:278480
Tryp_SPc 361..597 CDD:214473 79/263 (30%)
Tryp_SPc 362..600 CDD:238113 80/265 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.