DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and GZMH

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:263 Identity:78/263 - (29%)
Similarity:123/263 - (46%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EPLVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHV 161
            :|.:|      |:..:|..|| ..:.|.||....||..||...:...:.|....|||.|:....|
Human     2 QPFLL------LLAFLLTPGA-GTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFV 59

  Fly   162 ITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVS 226
            :|||||  ......|.|||:   |.||:.:.:..:|.:....:|.:|||...:||.:::|.....
Human    60 LTAAHC--QGSSINVTLGAH---NIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAK 119

  Fly   227 FNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSY 291
            :...:.|::||....:.:  ..:|...:||| |.: :..::..|:.|.|.:.....|:..|..:|
Human   120 WTTAVRPLRLPSSKAQVK--PGQLCSVAGWG-YVS-MSTLATTLQEVLLTVQKDCQCERLFHGNY 180

  Fly   292 -RGTNICTSG-RNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYL 354
             |.|.||... :..::...||||||||.      |.|..||.|:|:..|..   |..:.||:.:|
Human   181 SRATEICVGDPKKTQTGFKGDSGGPLVC------KDVAQGILSYGNKKGTP---PGVYIKVSHFL 236

  Fly   355 DWI 357
            .||
Human   237 PWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 70/236 (30%)
Tryp_SPc 123..359 CDD:238113 72/237 (30%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 72/237 (30%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.