DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Cela3b

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:246 Identity:72/246 - (29%)
Similarity:124/246 - (50%) Gaps:16/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGL-YWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKN 185
            |:..|:...|:.:|:||.:..::.... :.|||:||:...|:||.||:..::...|.||  |.:.
  Rat    27 RVVNGEDAVPYSWPWQVSLQYEKDGSFHHTCGGTLIAPDWVMTAGHCISTSRTYQVVLG--EFER 89

  Fly   186 AKEKGQVRLM-VPSENFQIYPTWNPKRLK--DDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFK 247
            ..|:|..::: |.:.:..::|.||...:.  :|||:|:|..:....:.:....||...   ....
  Rat    90 GVEEGPEQVIPVNAGDLFVHPKWNSNCVSCGNDIALVKLSRSAQLGDTVQLACLPPAG---EILP 151

  Fly   248 NKL-AIASGWGRYATGVHAISNVLRYVQLQIIDGRTCK--SNFPLSYRGTNICTSGRNARSTCNG 309
            |.. ...|||||.:|. ..:.:.|:...|.::|...|.  ..:..|.:.|.:|..| :.:|.|||
  Rat   152 NGAPCYISGWGRLSTN-GPLPDKLQQALLPVVDYAHCSKWDWWGFSVKKTMVCAGG-DIQSGCNG 214

  Fly   310 DSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWISD 359
            ||||||.....:...:| .|:|||.|..||:. ..|..||:|:::.:||.:
  Rat   215 DSGGPLNCPAENGTWQV-HGVTSFVSSLGCNTLKKPTVFTRVSAFNEWIEE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 70/242 (29%)
Tryp_SPc 123..359 CDD:238113 71/243 (29%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 70/242 (29%)
Tryp_SPc 28..265 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.