DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Klk1c9

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_786935.1 Gene:Klk1c9 / 292868 RGDID:727805 Length:259 Species:Rattus norvegicus


Alignment Length:256 Identity:70/256 - (27%)
Similarity:110/256 - (42%) Gaps:35/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFL 178
            |.|   ..|:.||.....:..|:||.::     |..:|||.||....|||||||  .:|...|.|
  Rat    19 PPG---QSRVVGGYNCETNSQPWQVAVI-----GTTFCGGVLIDPSWVITAAHC--YSKNYRVLL 73

  Fly   179 GANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLK-----------DDIAIVRLPHAVSFNERIH 232
            |.|.:...:...|.||:  |::|| :|.:.|..::           :|:.::.|.........:.
  Rat    74 GRNNLVKDEPFAQRRLV--SQSFQ-HPDYIPVFMRNHTRQRAYDHNNDLMLLHLSKPADITGGVK 135

  Fly   233 PIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNIC 297
            .|.||....:..|    :.:|||||........:|:.|:.|.:.::....|...:........:|
  Rat   136 VIDLPTEEPKVGS----ICLASGWGMTNPSEMKLSHDLQCVNIHLLSNEKCIETYKNIETDVTLC 196

  Fly   298 TSGRN-ARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
            ....: .:.||.|||||||:..      .||.|:||.|:........||.:.|:..:..||
  Rat   197 AGEMDGGKDTCTGDSGGPLICD------GVLQGLTSGGATPCAKPKTPAIYAKLIKFTSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 66/246 (27%)
Tryp_SPc 123..359 CDD:238113 67/247 (27%)
Klk1c9NP_786935.1 Tryp_SPc 24..251 CDD:214473 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.