DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Tpsb2

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:282 Identity:75/282 - (26%)
Similarity:125/282 - (44%) Gaps:42/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LVLNLETTPLMEKMLPEGAMAMDR--IFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHV 161
            |:|.|..:||...:.........|  |.||...:...:|:||.:..:....:::||||||..:.|
  Rat     4 LLLLLALSPLASLVHAAPCPVKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWV 68

  Fly   162 ITAAHCVDMAKRALVFLGANEIKNAKEKGQVRL----------MVPSENFQIYPTWNPKRLKDDI 216
            :||||||.:           .|| :.|..:|:|          ::......::|.:.......||
  Rat    69 LTAAHCVGL-----------HIK-SPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADI 121

  Fly   217 AIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNV-LRYVQLQIIDG 280
            |::.|.:.|:.:..|||..||.....:.|  ......:|||...:....:... |:.|::.|::.
  Rat   122 ALLELENPVNVSTHIHPTSLPPASETFPS--GTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVEN 184

  Fly   281 RTCKSNFPLS-YRGTNI--------CTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSI 336
            ..|...:... |.|.::        | :|.....:|.||||||||.:.:.:  .:..|:.|:|. 
  Rat   185 SLCDRKYHTGLYTGDDVPIVQDGMLC-AGNTRSDSCQGDSGGPLVCKVKGT--WLQAGVVSWGE- 245

  Fly   337 YGC-DRGYPAAFTKVASYLDWI 357
             || :...|..:|:|..|||||
  Rat   246 -GCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/257 (26%)
Tryp_SPc 123..359 CDD:238113 69/256 (27%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 69/256 (27%)
Tryp_SPc 30..266 CDD:214473 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.