DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Ctsg

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_006252103.1 Gene:Ctsg / 290257 RGDID:1307681 Length:285 Species:Rattus norvegicus


Alignment Length:305 Identity:87/305 - (28%)
Similarity:131/305 - (42%) Gaps:60/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNA 186
            :|.||....|:..||...:|:|.|:||..|||.|:.:..|:||.||  ......|.|||:.|:  
  Rat    20 KIIGGREARPNSHPYMAFLLIQSPEGLSACGGFLVREDFVLTAGHC--FGSSINVTLGAHNIR-- 80

  Fly   187 KEKGQVRLMVPSENFQIYPTWNPKR-LKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKL 250
            :::|..:.:......: :|.:||.. :::||.:::|......:..:.|:.||:.  ..|.....|
  Rat    81 RQEGTQQHITVLRAIR-HPDYNPPPVIQNDIMLLQLRSRARRSRAVKPVALPQA--TKRVQPGAL 142

  Fly   251 AIASGWG----RYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSG-RNARSTCNGD 310
            ...:|||    |..|      |||:.|:|::...:||.:.|......|.||... |..:|...||
  Rat   143 CTVAGWGLVSQRRGT------NVLQEVKLRVQTDQTCANRFQFYNSQTQICVGNPRERKSAFKGD 201

  Fly   311 SGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVSAHQDTTEAIFF 375
            ||||||.      ..|..||.|:||..|   ..||.||::.|::.||.                 
  Rat   202 SGGPLVC------NNVAQGIVSYGSSSG---NPPAVFTRIQSFMPWIK----------------- 240

  Fly   376 DQYVREYGKPRQSRRLETEEQLEDDVPDELDVHPRPASDEDISEN 420
                      |..|||.:.:  ||   .:||....|........|
  Rat   241 ----------RTMRRLSSSK--ED---SKLDSKQGPGHPSKFKSN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 75/240 (31%)
Tryp_SPc 123..359 CDD:238113 77/241 (32%)
CtsgXP_006252103.1 Tryp_SPc 20..239 CDD:214473 75/240 (31%)
Tryp_SPc 21..242 CDD:238113 77/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.