DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and TMPRSS11E

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:260 Identity:75/260 - (28%)
Similarity:117/260 - (45%) Gaps:45/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAK---RALVFLGANEI 183
            ||.||.......:|:|..:   :..|.:.||.:||:...:::||||....|   |.....|.. |
Human   191 RIVGGTEVEEGEWPWQASL---QWDGSHRCGATLINATWLVSAAHCFTTYKNPARWTASFGVT-I 251

  Fly   184 KNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKN 248
            |.:|.|..:|.::..|.:: :|:.:     .||::..|...|.:...:|.:.||...||::    
Human   252 KPSKMKRGLRRIIVHEKYK-HPSHD-----YDISLAELSSPVPYTNAVHRVCLPDASYEFQ---- 306

  Fly   249 KLAIASGWGRYATGVHAI------SNVLRYVQLQIIDGRTCKSNFPLSYRGT----NICTSGRNA 303
                 .|...:.||..|:      .|.||..|:.:||..||  |.|.:|...    .:|......
Human   307 -----PGDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTC--NEPQAYNDAITPRMLCAGSLEG 364

  Fly   304 RS-TCNGDSGGPLVLQRRHSKKR---VLVGITSFGSIYGCDR-GYPAAFTKVASYLDWISDETGV 363
            :: .|.||||||||    .|..|   .|.||.|:|.  .|.: ..|..:|:|.:..|||:.:||:
Human   365 KTDACQGDSGGPLV----SSDARDIWYLAGIVSWGD--ECAKPNKPGVYTRVTALRDWITSKTGI 423

  Fly   364  363
            Human   424  423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/252 (28%)
Tryp_SPc 123..359 CDD:238113 72/253 (28%)
TMPRSS11ENP_054777.2 SEA 51..156 CDD:307516
Tryp_SPc 192..420 CDD:238113 72/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.