DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Prss30

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:277 Identity:80/277 - (28%)
Similarity:120/277 - (43%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALV 176
            :|..||   .:|.||.......:|:||.  |:..|..:.||||||.:..|:|||||......:..
  Rat    23 ILHSGA---GKIVGGQDAPEGRWPWQVS--LRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSF 82

  Fly   177 FLGANEIKNAKEKGQV-------RLMVPSENFQIYPT--WNPKRLKDDIAIVRLPHAVSFNERIH 232
            :       :.|..|..       ..:|...|..:|||  |.... ..|||::||...:. ..:..
  Rat    83 Y-------HVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDAS-SGDIALLRLDTPLQ-PSQFS 138

  Fly   233 PIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPL---SYRGT 294
            |:.||:......  ...:...:|||  ||....:::||:.:.:.::|...|:..:.:   |..|.
  Rat   139 PVCLPQAQAPLT--PGTVCWVTGWG--ATHERELASVLQELAVPLLDSEDCERMYHIGETSLSGK 199

  Fly   295 NICTSG-------RNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVA 351
            .:..|.       ...:.:|.||||||||.....|  .:.|||||:|  .||.| ..|..:|:|.
  Rat   200 RVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSS--WIQVGITSWG--IGCARPNKPGVYTRVP 260

  Fly   352 SYLDWISDETGVSAHQD 368
            .|:||| ..|....|.|
  Rat   261 DYVDWI-QRTLAENHSD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 72/254 (28%)
Tryp_SPc 123..359 CDD:238113 74/255 (29%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.