DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG33462

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:304 Identity:77/304 - (25%)
Similarity:113/304 - (37%) Gaps:65/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DVGNPHCF------------PYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLG 179
            |.|.||..            |:..  .|:.|||.: |.|:||:...|:||||||.......|.||
  Fly    28 DCGIPHNISERSVNAKLAQNPWMA--YLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLG 89

  Fly   180 ANEIKNAKEKGQVRLMVPSENFQIYPT--------WNPKRLKDDIAIVRLPHAVSFNERIHPIQL 236
            .   .|.|.|......:..|.||.|..        :|.....:||.::||...|.:...|.||.:
  Fly    90 E---YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI 151

  Fly   237 PKRHYEYRSFKNKL-----AIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNI 296
                :....|:..:     ...:.|..  |..:|.|.|||.:.:......||...:..:.....|
  Fly   152 ----FASNRFQEPIDQLTWFTTTVWRE--TAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQI 210

  Fly   297 CTSGRNARSTCNGDSGGPLVLQRRH--SKKRVLVGITSFGSIYG-CDRGYPAAFTKVASYLDWIS 358
            | :|......|:.|||.|.:.:..|  |.:.|.:||.|  .:.| |...  .....:.||.|||.
  Fly   211 C-AGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIAS--RVKGQCQNS--GILMDLLSYADWIK 270

  Fly   359 DETGVSAHQDTTEAIFFDQYVREYGKPRQSRRLETEEQLEDDVP 402
                              :.||:||......|  :.::..|.:|
  Fly   271 ------------------RVVRQYGPSTDMNR--SLKKWVDKIP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/257 (26%)
Tryp_SPc 123..359 CDD:238113 70/259 (27%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/258 (26%)
Tryp_SPc 48..269 CDD:214473 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436438
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.