DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Sp212

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:369 Identity:92/369 - (24%)
Similarity:144/369 - (39%) Gaps:99/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WQQVKPMYLVSMYPGPAGLSTSSSS---------PFSSSGSLEHDAEMSASNVDNR-HIKGLGMG 84
            |.|..|...::..| |....|||.:         |...:......|.......|.| .|..:..|
  Fly   205 WNQPVPSVPITFAP-PVPTITSSPAPAPPPPPPLPTPPAVVTVPPATPPPQRFDPRSQISSVVCG 268

  Fly    85 REMSALSEEDDREPLVLNLETTPLMEK--MLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKG 147
            ||.|                |||.:.:  ..|.|.                :|:...:..:..:.
  Fly   269 REGS----------------TTPFIVRGNEFPRGQ----------------YPWLSAVYHKEVRA 301

  Fly   148 L-YWCGGSLISDKHVITAAHCVD--MAKRALVFLGANEIKNAKEKGQ-----VRLMVPSENFQIY 204
            | :.|.|||||...||:|||||.  ...|.:|.||..::.:..|.|.     :||:       .:
  Fly   302 LAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLL-------WH 359

  Fly   205 PTWNPKRLKD-DIAIVRLPHAVSFNERIHPIQL----PKRHYEYRSFKNKLAIASGWGRYATGVH 264
            |.:|.:...| |||::.:...|:||:.|.||.:    ..|......|      .:||||....  
  Fly   360 PDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGF------IAGWGRDEDS-- 416

  Fly   265 AISNVLRYVQLQIIDGRTCKSNFPLSYRGT-----NICTSGRNARSTCNGDSGGPLVLQRRHSKK 324
            :.:...|.|:.:|.....|.|    ::|||     ::|...|:....|.|||||.|::  :...:
  Fly   417 SRTQYPRVVEAEIASPTVCAS----TWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMV--KQGDR 475

  Fly   325 RVLVGITSFGSIYGCDRGYPAA---------FTKVASYLDWISD 359
            .:|.||.|.|     :|| ||.         :..::.:::|||:
  Fly   476 WLLRGIVSAG-----ERG-PAGTCQLNQYVLYCDLSKHINWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 67/261 (26%)
Tryp_SPc 123..359 CDD:238113 69/262 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 72/280 (26%)
Tryp_SPc 277..511 CDD:214473 69/276 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.